Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
MASSGQLLKLVCLVAVMCCMAVGGPKAMAAVSCGQVVNNLTPCINYVANGGALNPSCCTGVRSLYSLAQTTADRQSICNCLKQAVNGIPYTNANAGLAAGLPGKCGVNIPYKISPSTDCKTIK
None.
Species containing the peptide ISPSTDCK are presented below. Accessions and taxid values link to further information hosted on NCBI.
Species name | Common name | Accession(s) | Tax ID |
---|---|---|---|
Cuphea paucipetala | Cuphea paucipetala | AGL08241 AGL08240 AGL08243 AGL08242 |
857164 |
Eucalyptus grandis | Eucalyptus grandis | XP_010043259 KCW88359 |
71139 |
Gossypium barbadense | Sea-island cotton | XP_012454351 |
3634 |
Gossypium hirsutum | Upland cotton | XP_012454351 AGC08428 |
3635 |
Gossypium raimondii | Gossypium raimondii | XP_012454351 KJB71535 |
29730 |
Malus domestica | Apple | XP_008388344 XP_008370253 |
3750 |
Morus nigra | Morus nigra | P85894 |
85232 |
Populus euphratica | Populus euphratica | XP_011007240 |
75702 |
Populus trichocarpa | Black cottonwood | XP_006387199 XP_002305878 ABK94706 |
3694 |
Populus trichocarpa x Populus deltoides | Populus trichocarpa x populus deltoides | ABK96515 |
3695 |
Prunus dulcis | Almond | XP_007206148 ACN11576 |
3755 |
Prunus dulcis x Prunus persica | Prunus dulcis x prunus persica | XP_007206148 |
472390 |
Prunus mume | Japanese apricot | XP_008244918 XP_008244911 |
102107 |
Prunus persica | Peach | XP_007206148 AAM22767 |
3760 |
Pyrus x bretschneideri | Pyrus x bretschneideri | XP_009346911 XP_009372010 |
225117 |
Ricinus communis | Castor bean | XP_002528683 |
3988 |
Theobroma cacao | Cacao | XP_017974829 EOY04474 |
3641 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.