Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
MASSGQLLKLVCLVAVMCCMAVGGPKAMAAVSCGQVVNNLTPCINYVANGGALNPSCCTGVRSLYSLAQTTADRQSICNCLKQAVNGIPYTNANAGLAAGLPGKCGVNIPYKISPSTDCKTIK
None.
Species containing the peptide MASSGQLLK are presented below. Accessions and taxid values link to further information hosted on NCBI.
Species name | Common name | Accession(s) | Tax ID |
---|---|---|---|
Malus domestica | Apple | XP_008388344 XP_008370253 |
3750 |
Prunus dulcis | Almond | XP_007206148 ACN11576 |
3755 |
Prunus dulcis x Prunus persica | Prunus dulcis x prunus persica | XP_007206148 |
472390 |
Prunus mume | Japanese apricot | XP_008244918 XP_008244911 |
102107 |
Prunus persica | Peach | XP_007206148 AAM22767 |
3760 |
Pyrus x bretschneideri | Pyrus x bretschneideri | XP_009346911 XP_009372010 |
225117 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.