Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
MKVVAAYLLAVLGGNTTPSAEDLKDILGSVGAETDDDRIQLLLSEVKGKDITELIASGREKLASVPSGGGAVAVAAPGAGAGAAAPAAAEPKKEEKVEEKEDTDDDMGFSLFD
None.
Species containing the peptide IQLLLSEVK are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Capsicum annuum | Capsicum annuum | XP_016577917 |
4072 |
| Gossypium arboreum | Gossypium arboreum | XP_017620362 |
29729 |
| Gossypium hirsutum | Upland cotton | XP_016711759 |
3635 |
| Malus domestica | Apple | XP_008391761 |
3750 |
| Prunus dulcis | Almond | XP_008241270 |
3755 |
| Prunus mume | Japanese apricot | XP_008241270 XP_016651805 |
102107 |
| Prunus persica | Peach | XP_007202715 |
3760 |
| Pyrus x bretschneideri | Pyrus x bretschneideri | XP_009366640 XP_009374748 |
225117 |
| Theobroma cacao | Cacao | XP_007027672 |
3641 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.