Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
MACAHLCKEADIKTALEACKAADTFSFKTFFHTIGFASKSADDVKKAFKVIDQDASGFIEVEELKLFLQNFCPKARELTDAETKAFLKAGDADGDGMIGIDEFAVLVKQ
None.
Species containing the peptide ELTDAETK are presented below. Accessions and taxid values link to further information hosted on NCBI.
Species name | Common name | Accession(s) | Tax ID |
---|---|---|---|
Ictalurus punctatus | Channel catfish | XP_017348340 XP_017348333 |
7998 |
Oncorhynchus mykiss | Rainbow trout | CBA35341 |
8022 |
Plasmodium coatneyi | Plasmodium coatneyi | ANQ07849 |
208452 |
Pygocentrus nattereri | Red-bellied piranha | XP_017574624 XP_017574931 XP_017574623 XP_017574930 XP_017574929 |
42514 |
Salmo salar | Atlantic salmon | AGG35870 ACH71041 XP_014049624 NP_001117190 CBA35349 XP_014058479 |
8030 |
Salmo trutta | Brown trout | AGG35877 |
8032 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.