Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
MACAHLCKEADIKTALEACKAADTFSFKTFFHTIGFASKSADDVKKAFKVIDQDASGFIEVEELKLFLQNFCPKARELTDAETKAFLKAGDADGDGMIGIDEFAVLVKQ
Species containing the peptide VIDQDASGFIEVEELK are presented below. Accessions and taxid values link to further information hosted on NCBI.
Species name | Common name | Accession(s) | Tax ID |
---|---|---|---|
Oncorhynchus kisutch | Coho salmon | CBG76586 |
8019 |
Oncorhynchus mykiss | Rainbow trout | AGG35867 NP_001182339 CBA35341 CDQ83771 |
8022 |
Salmo salar | Atlantic salmon | AGG35870 ACH71041 XP_014049624 NP_001117190 CBA35349 XP_014058479 |
8030 |
Salmo trutta | Brown trout | AGG35877 |
8032 |
Salvelinus alpinus | Arctic char | AGG35867 |
8036 |
Salvelinus fontinalis | Brook trout | NP_001182339 |
8038 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.