Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
MAYSWDNRVKYVVRYMYDIDNNGFLDKNDFECLAVRNTLIEGRGEFSADAYANNQKIMRNLWNEIAELADFNKDGEVTVDEFKQAVQKHCQGKKYGDFPGAFKVFIANQFKAIDVNGDGKVGLDEYRLDCITRSAFAEVKEIDDAYNKLTTEDDRKAGGLTLERYQDLYAQFISNPDESCSACYLFGPLKVVQ
Food | Protein | Taxid |
---|---|---|
Shrimp | Lit-v-4.0101 | 6689 |
Shrimp | Pen-m-4.0101 | 6687 |
Species containing the peptide AGGLTLER are presented below. Accessions and taxid values link to further information hosted on NCBI.
Species name | Common name | Accession(s) | Tax ID |
---|---|---|---|
Fenneropenaeus orientalis | Fenneropenaeus orientalis | 1006232A 1006232A |
70917 |
Haloterrigena turkmenica | Haloterrigena turkmenica | WP_012942970 WP_012942970 |
62320 |
Haloterrigena turkmenica DSM 5511 | Haloterrigena turkmenica dsm 5511 | WP_012942970 WP_012942970 |
543526 |
Litopenaeus vannamei | Pacific white shrimp | ACM89179 ACM89179 |
6689 |
Methanopyrus kandleri AV19 | Methanopyrus kandleri av19 | AAM02164 AAM02164 |
190192 |
Penaeus monodon | Black tiger shrimp | BAL72725 ACM89179 BAL72725 ACM89179 |
6687 |
Penaeus sp. | Penaeus sp. | P02636 P02636 |
6688 |
Thermococcus sp. 4557 | Thermococcus sp. 4557 | WP_014013572 WP_014013572 |
1042877 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.