Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
MAYSWDNRVKYVVRYMYDIDNNGFLDKNDFECLAVRNTLIEGRGEFSADAYANNQKIMRNLWNEIAELADFNKDGEVTVDEFKQAVQKHCQGKKYGDFPGAFKVFIANQFKAIDVNGDGKVGLDEYRLDCITRSAFAEVKEIDDAYNKLTTEDDRKAGGLTLERYQDLYAQFISNPDESCSACYLFGPLKVVQ
None.
| Food | Protein | Taxid |
|---|---|---|
| Shrimp | Lit-v-4.0101 | 6689 |
| Shrimp | Pen-m-4.0101 | 6687 |
Species containing the peptide MAYSWDNR are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Acromyrmex echinatior | Panamanian leafcutter ant | XP_011054770 XP_011054770 |
103372 |
| Apis cerana | Asiatic honeybee | XP_003693203 XP_003693203 |
7461 |
| Apis dorsata | Giant honeybee | XP_003693203 XP_003693203 |
7462 |
| Apis florea | Little honeybee | XP_003693203 XP_003693203 |
7463 |
| Apis mellifera | Honey bee | XP_623244 XP_006570446 XP_623244 XP_006570446 |
7460 |
| Athalia rosae | Coleseed sawfly | XP_012258612 XP_012258611 XP_012258612 XP_012258611 |
37344 |
| Atta colombica | Atta colombica | XP_018045788 XP_018045788 |
520822 |
| Bombyx mori | Domestic silkworm | XP_012544320 XP_012544320 |
7091 |
| Caligus rogercresseyi | Caligus rogercresseyi | ACO11179 ACO10496 ACO11179 ACO10496 |
217165 |
| Cephus cinctus | Wheat stem sawfly | XP_015594627 XP_015594615 XP_015594627 XP_015594615 |
211228 |
| Cerapachys biroi | Cerapachys biroi | XP_011329199 XP_011329199 |
443821 |
| Ceratosolen solmsi marchali | Ceratosolen solmsi marchali | XP_011502063 XP_011502063 |
326594 |
| Copidosoma floridanum | Copidosoma floridanum | XP_014211085 XP_014211085 |
29053 |
| Diachasma alloeum | Diachasma alloeum | XP_015113282 XP_015113282 |
454923 |
| Dinoponera quadriceps | Dinoponera quadriceps | XP_014480786 XP_014480786 |
609295 |
| Drosophila ananassae | Drosophila ananassae | XP_001965911 XP_001965911 |
7217 |
| Drosophila bipectinata | Drosophila bipectinata | XP_017104217 XP_017104217 |
42026 |
| Drosophila busckii | Drosophila busckii | XP_017840611 XP_017840611 |
30019 |
| Drosophila erecta | Drosophila erecta | XP_001970923 XP_001970923 |
7220 |
| Drosophila grimshawi | Drosophila grimshawi | XP_001992927 XP_001992927 |
7222 |
| Drosophila persimilis | Drosophila persimilis | XP_002028138 XP_002028138 |
7234 |
| Drosophila willistoni | Drosophila willistoni | XP_015031913 XP_015031913 |
7260 |
| Drosophila yakuba | Drosophila yakuba | XP_015045326 XP_001970923 XP_015045326 XP_001970923 |
7245 |
| Eriocheir sinensis | Chinese mitten crab | AJG01361 AJG01360 AJG01359 AJG01361 AJG01360 AJG01359 |
95602 |
| Habropoda laboriosa | Habropoda laboriosa | XP_017793082 XP_017793082 |
597456 |
| Hyalella azteca | Hyalella azteca | XP_018019896 XP_018019895 XP_018019896 XP_018019895 |
294128 |
| Lepeophtheirus salmonis | Salmon louse | ADD24234 ACO12721 ACO11757 ADD24234 ACO12721 ACO11757 |
72036 |
| Linepithema humile | Argentine ant | XP_012221167 XP_012221167 |
83485 |
| Litopenaeus vannamei | Pacific white shrimp | ACM89179 ACM89179 |
6689 |
| Lucilia cuprina | Australian sheep blowfly | KNC33335 KNC33335 |
7375 |
| Microplitis demolitor | Microplitis demolitor | XP_008551022 XP_008551022 |
69319 |
| Monomorium pharaonis | Pharaoh ant | XP_012534124 XP_012534124 |
307658 |
| Musca domestica | House fly | XP_005183452 XP_005183452 |
7370 |
| Nasonia vitripennis | Jewel wasp | XP_001607410 XP_001607410 |
7425 |
| Neodiprion lecontei | Redheaded pine sawfly | XP_015516368 XP_015516367 XP_015516368 XP_015516367 |
441921 |
| Nicrophorus vespilloides | Nicrophorus vespilloides | XP_017786658 XP_017786657 XP_017786658 XP_017786657 |
110193 |
| Operophtera brumata | Winter moth | KOB77245 KOB77245 |
104452 |
| Penaeus monodon | Black tiger shrimp | BAL72725 ACM89179 BAL72725 ACM89179 |
6687 |
| Pogonomyrmex barbatus | Red harvester ant | XP_011630044 XP_011630044 |
144034 |
| Polistes canadensis | Polistes canadensis | XP_014609082 XP_014609082 |
91411 |
| Polistes dominula | Polistes dominula | XP_015181929 XP_015181929 |
743375 |
| Procambarus clarkii | Red swamp crayfish | ABB58783 AEG79569 AEG79568 AEG79567 ABB58783 AEG79569 AEG79568 AEG79567 |
6728 |
| Scylla paramamosain | Green mud crab | AFJ80778 AFJ80778 |
85552 |
| Solenopsis invicta | Red fire ant | XP_011167416 XP_011167416 |
13686 |
| Stomoxys calcitrans | Stable fly | XP_013101678 XP_013101678 |
35570 |
| Tribolium castaneum | Red flour beetle | XP_967547 XP_008199809 XP_967547 XP_008199809 |
7070 |
| Trichogramma pretiosum | Trichogramma pretiosum | XP_014227739 XP_014227739 |
7493 |
| Vollenhovia emeryi | Vollenhovia emeryi | XP_011881115 XP_011881115 |
411798 |
| Wasmannia auropunctata | Little fire ant | XP_011685141 XP_011685140 XP_011685139 XP_011685141 XP_011685140 XP_011685139 |
64793 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.