Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
MAYSWDNRVKYVVRYMYDIDNNGFLDKNDFECLAVRNTLIEGRGEFSADAYANNQKIMRNLWNEIAELADFNKDGEVTVDEFKQAVQKHCQGKKYGDFPGAFKVFIANQFKAIDVNGDGKVGLDEYRLDCITRSAFAEVKEIDDAYNKLTTEDDRKAGGLTLERYQDLYAQFISNPDESCSACYLFGPLKVVQ
Food | Protein | Taxid |
---|---|---|
Shrimp | Lit-v-4.0101 | 6689 |
Shrimp | Pen-m-4.0101 | 6687 |
Species containing the peptide VGLDEYR are presented below. Accessions and taxid values link to further information hosted on NCBI.
Species name | Common name | Accession(s) | Tax ID |
---|---|---|---|
Caligus rogercresseyi | Caligus rogercresseyi | ACO11179 ACO10496 ACO11179 ACO10496 |
217165 |
Fenneropenaeus orientalis | Fenneropenaeus orientalis | 1006232A 1006232A |
70917 |
Lepeophtheirus salmonis | Salmon louse | ADD24234 ACO12721 ACO11757 ADD24234 ACO12721 ACO11757 |
72036 |
Litopenaeus vannamei | Pacific white shrimp | ACM89179 ACM89179 |
6689 |
Marsupenaeus japonicus | Marsupenaeus japonicus | BAL72726 BAL72726 |
27405 |
Mucor ambiguus | Mucor ambiguus | GAN05372 GAN05372 |
91626 |
Penaeus monodon | Black tiger shrimp | BAL72725 ACM89179 BAL72725 ACM89179 |
6687 |
Penaeus sp. | Penaeus sp. | P02636 P02636 |
6688 |
Phaeosphaeria nodorum SN15 | Phaeosphaeria nodorum sn15 | XP_001804784 XP_001804784 |
321614 |
Tilletia caries | Wheat bunt fungus | OAJ24172 OAJ24172 |
13290 |
Tilletia controversa | Dwarf bunt fungus | OAJ30425 OAJ30425 |
13291 |
Tilletia indica | Tilletia indica | OAJ05155 OAJ05155 |
43049 |
Tilletia walkeri | Tilletia walkeri | OAJ13254 OAJ13254 |
117179 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.