If you found this site useful, please cite:

Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.

Peptide: QLQQQEQIK

Peptide within the protein Ana-o-3:

MAKFLLLLSAFAVLLLVANASIYRAIVEVEEDSGREQSCQRQFEEQQRFRNCQRYVKQEVQRGGRYNQRQESLRECCQELQEVDRRCRCQNLEQMVRQLQQQEQIKGEEVRELYETASELPRICSISPSQGCQFQSSY

References reporting this peptide:


Species Uniqueness

Species containing the peptide QLQQQEQIK are presented below. Accessions and taxid values link to further information hosted on NCBI.

Species name Common name Accession(s) Tax ID
Anacardium occidentale Cashew AAL91665
171929

BLAST non-redundant protein database version: 4, date: December 9, 2015.

See the About page for more information.