Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
MAMAGVFVLFSFVLCGFLPDAAFGAEVDCSRFPNATDKEGKDVLVCNKDLRPICGTDGVTYTNDCLLCAYSIEFGTNISKEHDGECKETVPMNCSSYANTTSEDGKVMVLCNRAFNPVCGTDGVTYDNECLLCAHKVEQGASVDKRHDGGCRKELAAVSVDCSEYPKPDCTAEDRPLCGSDNKTYGNKCNFCNAVVESNGTLTLSHFGKC
None.
Species containing the peptide EHDGECK are presented below. Accessions and taxid values link to further information hosted on NCBI.
Species name | Common name | Accession(s) | Tax ID |
---|---|---|---|
Cajanus cajan | Pigeon pea | KYP67030 |
3821 |
Cicer arietinum | Chickpea | XP_004511768 |
3827 |
Drechmeria coniospora | Drechmeria coniospora | ODA83637 KYK60952 |
98403 |
Gallus gallus | Chicken | 0807280A NP_001106132 NP_001295423 ACJ04729 |
9031 |
Glycine max | Soybean | XP_006573695 XP_006573692 |
3847 |
Glycine soja | Glycine soja | KHN42627 |
3848 |
Phaseolus vulgaris | Phaseolus vulgaris | XP_007156636 |
3885 |
Saccoglossus kowalevskii | Saccoglossus kowalevskii | XP_002731056 |
10224 |
Vigna angularis | Adzuki bean | XP_017427650 KOM44884 |
3914 |
Vigna angularis var. angularis | Vigna angularis var. angularis | XP_017427650 |
157739 |
Vigna radiata var. radiata | Mung bean | XP_014520921 XP_014520920 XP_014520918 |
3916 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.