Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
MAMAGVFVLFSFVLCGFLPDAAFGAEVDCSRFPNATDKEGKDVLVCNKDLRPICGTDGVTYTNDCLLCAYSIEFGTNISKEHDGECKETVPMNCSSYANTTSEDGKVMVLCNRAFNPVCGTDGVTYDNECLLCAHKVEQGASVDKRHDGGCRKELAAVSVDCSEYPKPDCTAEDRPLCGSDNKTYGNKCNFCNAVVESNGTLTLSHFGKC
None.
Species containing the peptide FPNATDK are presented below. Accessions and taxid values link to further information hosted on NCBI.
Species name | Common name | Accession(s) | Tax ID |
---|---|---|---|
Colletotrichum gloeosporioides Cg-14 | Colletotrichum gloeosporioides cg-14 | EQB52875 |
1237896 |
Colletotrichum gloeosporioides Nara gc5 | Colletotrichum gloeosporioides nara gc5 | XP_007274889 |
1213859 |
Galactomyces candidum | Galactomyces candidum | CDO58007 |
1173061 |
Gallus gallus | Chicken | 0807280A NP_001106132 NP_001295423 |
9031 |
Mycosphaerella eumusae | Mycosphaerella eumusae | KXS98213 |
321146 |
Operophtera brumata | Winter moth | KOB68530 |
104452 |
Oxytricha trifallax | Oxytricha trifallax | EJY71293 |
1172189 |
Plasmopara halstedii | Plasmopara halstedii | CEG36380 |
4781 |
Stomoxys calcitrans | Stable fly | XP_013116002 |
35570 |
Stylonychia lemnae | Stylonychia lemnae | CDW79969 |
5949 |
Thalassiosira oceanica | Thalassiosira oceanica | EJK55373 |
159749 |
Trichuris suis | Pig whipworm | KFD69298 KFD48710 KHJ41839 |
68888 |
Trichuris trichiura | Human whipworm | CDW53129 |
36087 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.