Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
This rose plot enables visualization of proteotypic peptides. Each colored rose petal corresponds to a peptide and is bounded by thin gray petals, which represent tryptic cut sites. The radial magnitude of each peptide corresponds to the number of publications which report it.
Hover over a rose petal with your mouse to see the peptide. Click on a rose petal to see the species specificity of that peptide and add it to your cart.
MRSLLILVLCFLPLAALGKVFGRCELAAAMKRHGLDNYRGYSLGNWVCAAKFESNFNTQATNRNTDGSTDYGILQINSRWWCNDGRTPGSRNLCNIPCSALLSSDITASVNCAKKIVSDGNGMNAWVAWRNRCKGTDVQAWIRGCRL
UniProt: P00698 IUIS: Gal d 4Explore peptide targets for mass spectrometry by adjusting the selection criteria below. Results from empirical and computational prediction tools have been aggregated for convenience.
1 | Peptide | 2 | Exp.3 | ESP4 | CONSeQ5 |
---|---|---|---|---|---|
R | SLLILVLCFLPLAALGK | V | 0 | 0.403 | 0.2023 |
R | CELAAAMK | R | 1 | 0.234 | 0.46462 |
R | HGLDNYR | G | 2 | 0.314 | 0.10622 |
R | GYSLGNWVCAAK | F | 1 | 0.451 | 0.43796 |
K | FESNFNTQATNR | N | 7 | 0.584 | 0.44952 |
R | NTDGSTDYGILQINSR | W | 6 | 0.681 | 0.6132 |
R | WWCNDGR | T | 1 | 0.267 | 0.19536 |
R | NLCNIPCSALLSSDITASVNCAK | K | 1 | 0.496 | 0.17404 |
K | IVSDGNGMNAWVAWR | N | 0 | 0.404 | 0.2913 |
K | GTDVQAWIR | G | 3 | 0.401 | 0.62434 |
1 Previous amino acid (^ = Start of protein)
2 Next amino acid ($ = End of protein)
3 Exp. = Number of publications in which this peptide has been reported experimentally
4 ESP = ESP Predictor. Fusaro VA, et al. Nat Botechnol 2009; 27(2): 190-198. doi
5 CONSeQ = CONSeQuence. Eyers CE, et al. Mol Cell Proteomics 2011; 10(11). doi
Underline: Peptide occurs within the first 20 amino acids from the start of the protein. Use caution as the protein may contain a cleaved signaling sequence.
Strike-through: Peptide is present in a protein from another allergen species and is thus nonspecific.