Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
MRSLLILVLCFLPLAALGKVFGRCELAAAMKRHGLDNYRGYSLGNWVCAAKFESNFNTQATNRNTDGSTDYGILQINSRWWCNDGRTPGSRNLCNIPCSALLSSDITASVNCAKKIVSDGNGMNAWVAWRNRCKGTDVQAWIRGCRL
Species containing the peptide CELAAAMK are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Aix sponsa | Wood duck | Q7LZQ2 |
8833 |
| Alligator mississippiensis | American alligator | XP_006267124 |
8496 |
| Alligator sinensis | Chinese alligator | XP_006027022 |
38654 |
| Anas platyrhynchos | Mallard | EOB09190 0802160B 0802160A P00706 XP_005008937 P00705 |
8839 |
| Anser cygnoides domesticus | Anser cygnoides domesticus | XP_013053649 |
381198 |
| Apteryx australis mantelli | Apteryx australis mantelli | XP_013802731 XP_013802729 |
202946 |
| Bambusicola thoracica | Chinese bamboo-partridge | ACL81751 |
9083 |
| Callipepla californica | California quail | P00699 |
67771 |
| Catreus wallichii | Cheer pheasant | Q7LZP9 |
9085 |
| Chrysolophus amherstiae | Lady amherst's pheasant | P22910 |
9088 |
| Chrysolophus pictus | Golden pheasant | P22910 |
9089 |
| Colinus virginianus | Northern bobwhite | P00700 |
9014 |
| Coturnix japonica | Japanese quail | 2IHL_A XP_015711651 P00701 |
93934 |
| Crax fasciolata | Crax fasciolata | Q7LZQ3 |
84988 |
| Dromaius novaehollandiae | Emu | G3XDT7 |
8790 |
| Francolinus pondicerianus interpositus | Francolinus pondicerianus interpositus | ACL81753 |
588856 |
| Gallus gallus | Chicken | AAD10202 3ZVQ_A 1UIA_A 5HMV_A 1V7S_A 1NDG_C 1H6M_A 1LSN_A 1LZG_A 1UIC_A 1IR9_A 630460A 1UIE_A 1FLW_A 1NBY_C 1FLY_A 1AT5_A 1AT6_A 1HEP_A 1IR8_A 1KXY_A 1FLQ_A 1FN5_A 1KXW_A 1A2Y_C 1HER_A 1HEO_A 1HEQ_A 1HEN_A 1NBZ_C 2IFF_Y 3WW6_A 3WW5_A 3WVX_A 4YEO_A 3A3Q_A 1IR7_A 1LZD_A 1FDL_Y 1IO5_A 1HEM_A 1UIF_A 1UID_A 1KXX_A 1FLU_A 1LSM_A 3QY4_A 3OK0_A 3OJP_A 4MWN_A 1LSG_A 1LSY_A ACL81619 ACL81573 ACL81571 P00698 NP_990612 |
9031 |
| Gallus lafayetii | Ceylon junglefowl | P00698 |
9032 |
| Gallus sonneratii | Gray junglefowl | P00698 |
9033 |
| Gallus varius | Green junglefowl | ACL81755 |
9034 |
| Gavia stellata | Gavia stellata | XP_009814321 |
37040 |
| Lophophorus impejanus | Lophophorus impejanus | Q7LZP9 |
9040 |
| Lophura leucomelanos | Lophura leucomelanos | P24364 |
140445 |
| Meleagris gallopavo | Turkey | 1DZB_X 1LZ2_A XP_003202118 |
9103 |
| Numida meleagris | Helmeted guineafowl | P00704 1HHL_A |
8996 |
| Ortalis vetula | Plain chachalaca | P00707 |
8984 |
| Pavo cristatus | Indian peafowl | P19849 |
9049 |
| Phasianus colchicus | Ring-necked pheasant | 1JHL_A 1GHL_A LZFER |
9054 |
| Phasianus colchicus colchicus | Ring-necked pheasant | P00702 |
9057 |
| Phasianus versicolor | Green pheasant | P49663 |
9055 |
| Struthio camelus | African ostrich | XP_009670021 |
8801 |
| Struthio camelus australis | Struthio camelus australis | XP_009670021 |
441894 |
| Syrmaticus reevesii | Reeves's pheasant | P24533 |
9066 |
| Syrmaticus soemmerringii | Copper pheasant | P81711 2011187A |
9067 |
| Tinamus guttatus | Tinamus guttatus | XP_010209345 |
94827 |
| Tragopan satyra | Tragopan satyra | Q7LZI3 |
9070 |
| Tragopan temminckii | Tragopan temminckii | Q7LZT2 |
9071 |
| Tympanuchus cupido | Greater prairie chicken | ANZ02901 |
9004 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.