Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
MRSLLILVLCFLPLAALGKVFGRCELAAAMKRHGLDNYRGYSLGNWVCAAKFESNFNTQATNRNTDGSTDYGILQINSRWWCNDGRTPGSRNLCNIPCSALLSSDITASVNCAKKIVSDGNGMNAWVAWRNRCKGTDVQAWIRGCRL
Species containing the peptide HGLDNYR are presented below. Accessions and taxid values link to further information hosted on NCBI.
Species name | Common name | Accession(s) | Tax ID |
---|---|---|---|
Bambusicola thoracica | Chinese bamboo-partridge | ACL81751 |
9083 |
Callipepla californica | California quail | P00699 |
67771 |
Colinus virginianus | Northern bobwhite | P00700 |
9014 |
Francolinus pondicerianus interpositus | Francolinus pondicerianus interpositus | ACL81753 |
588856 |
Gallus gallus | Chicken | 1F3J_P 3MBE_P AAD10202 3ZVQ_A 5HMV_A 1V7S_A 1NDG_C 1H6M_A 1LSN_A 1LZG_A 1IR9_A 630460A 1FLW_A 1NBY_C 1FLY_A 1AT5_A 1AT6_A 1IOS_A 1HEP_A 1IR8_A 1FLQ_A 1IOQ_A 1FN5_A 1KXW_A 1IOT_A 1HER_A 1HEO_A 1HEQ_A 1HEN_A 1IOR_A 1NBZ_C 2IFF_Y 3WW6_A 3WW5_A 3WVX_A 4YEO_A 4N0J_A 3A3Q_A 1IR7_A 1LZD_A 1FDL_Y 1IO5_A 1HEM_A 1FLU_A 1LSM_A 3QY4_A 3OK0_A 3OJP_A 132L_A 4MWN_A 1LSG_A 1LSY_A ACL81619 ACL81573 ACL81571 P00698 NP_990612 |
9031 |
Gallus lafayetii | Ceylon junglefowl | P00698 |
9032 |
Gallus sonneratii | Gray junglefowl | P00698 |
9033 |
Gallus varius | Green junglefowl | ACL81755 |
9034 |
Numida meleagris | Helmeted guineafowl | P00704 1HHL_A |
8996 |
Takifugu rubripes | Torafugu | XP_011607031 |
31033 |
Tetrahymena thermophila SB210 | Tetrahymena thermophila sb210 | XP_012650971 |
312017 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.