Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
MRSLLILVLCFLPLAALGKVFGRCELAAAMKRHGLDNYRGYSLGNWVCAAKFESNFNTQATNRNTDGSTDYGILQINSRWWCNDGRTPGSRNLCNIPCSALLSSDITASVNCAKKIVSDGNGMNAWVAWRNRCKGTDVQAWIRGCRL
None.
Species containing the peptide IVSDGNGMNAWVAWR are presented below. Accessions and taxid values link to further information hosted on NCBI.
Species name | Common name | Accession(s) | Tax ID |
---|---|---|---|
Chrysolophus amherstiae | Lady amherst's pheasant | P22910 |
9088 |
Chrysolophus pictus | Golden pheasant | P22910 |
9089 |
Colinus virginianus | Northern bobwhite | P00700 |
9014 |
Crax fasciolata | Crax fasciolata | Q7LZQ3 |
84988 |
Francolinus pondicerianus interpositus | Francolinus pondicerianus interpositus | ACL81753 |
588856 |
Gallus gallus | Chicken | 3ZVQ_B 1UIA_A 5HMV_A 1V7S_A 1NDG_C 1H6M_A 1LZG_A 1UIC_A 1UIE_A 1FLW_A 1NBY_C 1IOS_A 1HEP_A 1IR8_A 1KXY_A 1FLQ_A 1IOQ_A 1FN5_A 1KXW_A 1IOT_A 1A2Y_C 1HER_A 1HEO_A 1HEQ_A 1HEN_A 1IOR_A 1NBZ_C 2IFF_Y 3WW6_A 3WW5_A 3WVX_A 4YEO_A 4N0J_A 3A3Q_A 1IR7_A 1LZD_A 1FDL_Y 1IO5_A 1HEM_A 1UIF_A 1UID_A 1KXX_A 1FLU_A 3QY4_A 3OK0_A 3OJP_A 132L_A 4MWN_A 1LSG_A 1LSY_A ACL81619 ACL81573 ACL81571 P00698 |
9031 |
Gallus lafayetii | Ceylon junglefowl | P00698 |
9032 |
Gallus sonneratii | Gray junglefowl | P00698 |
9033 |
Gallus varius | Green junglefowl | ACL81755 |
9034 |
Lophophorus impejanus | Lophophorus impejanus | Q7LZP9 |
9040 |
Lophura leucomelanos | Lophura leucomelanos | P24364 |
140445 |
Numida meleagris | Helmeted guineafowl | P00704 |
8996 |
Phasianus colchicus | Ring-necked pheasant | 1GHL_A |
9054 |
Phasianus colchicus colchicus | Ring-necked pheasant | P00702 |
9057 |
Syrmaticus soemmerringii | Copper pheasant | P81711 2011187A |
9067 |
Aix sponsa | Wood duck | Q7LZQ2 |
8833 |
Anas platyrhynchos | Mallard | XP_005008937 |
8839 |
Anser cygnoides domesticus | Anser cygnoides domesticus | XP_013053649 |
381198 |
Bambusicola thoracica | Chinese bamboo-partridge | ACL81751 |
9083 |
Callipepla californica | California quail | P00699 |
67771 |
Catreus wallichii | Cheer pheasant | Q7LZP9 |
9085 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.