Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
MRSLLILVLCFLPLAALGKVFGRCELAAAMKRHGLDNYRGYSLGNWVCAAKFESNFNTQATNRNTDGSTDYGILQINSRWWCNDGRTPGSRNLCNIPCSALLSSDITASVNCAKKIVSDGNGMNAWVAWRNRCKGTDVQAWIRGCRL
Species containing the peptide NLCNIPCSALLSSDITASVNCAK are presented below. Accessions and taxid values link to further information hosted on NCBI.
Species name | Common name | Accession(s) | Tax ID |
---|---|---|---|
Catreus wallichii | Cheer pheasant | Q7LZP9 |
9085 |
Coturnix japonica | Japanese quail | 2IHL_A XP_015711651 P00701 |
93934 |
Gallus gallus | Chicken | 3ZVQ_B 1UIA_A 5HMV_A 1V7S_A 1NDG_C 1H6M_A 1LZG_A 1UIC_A 1IR9_A 630460A 1UIE_A 1FLW_A 1FLY_A 1AT5_A 1AT6_A 1IOS_A 1IR8_A 1KXY_A 1FLQ_A 1IOQ_A 1FN5_A 1KXW_A 1IOT_A 1A2Y_C 1HER_A 1HEO_A 1IOR_A 1NBZ_C 2IFF_Y 3WW6_A 3WW5_A 3WVX_A 4YEO_A 3A3Q_A 1LZD_A 1FDL_Y 1IO5_A 1UIF_A 1UID_A 1KXX_A 1FLU_A 3QY4_A 3OK0_A 3OJP_A 4MWN_A 1LSG_A 1LSY_A ACL81619 ACL81573 ACL81571 P00698 NP_990612 |
9031 |
Gallus lafayetii | Ceylon junglefowl | P00698 |
9032 |
Gallus sonneratii | Gray junglefowl | P00698 |
9033 |
Lophophorus impejanus | Lophophorus impejanus | Q7LZP9 |
9040 |
Meleagris gallopavo | Turkey | 1DZB_X 1LZ2_A XP_003202118 |
9103 |
Pavo cristatus | Indian peafowl | P19849 |
9049 |
Tragopan satyra | Tragopan satyra | Q7LZI3 |
9070 |
Tragopan temminckii | Tragopan temminckii | Q7LZT2 |
9071 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.