Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
MRSLLILVLCFLPLAALGKVFGRCELAAAMKRHGLDNYRGYSLGNWVCAAKFESNFNTQATNRNTDGSTDYGILQINSRWWCNDGRTPGSRNLCNIPCSALLSSDITASVNCAKKIVSDGNGMNAWVAWRNRCKGTDVQAWIRGCRL
None.
Species containing the peptide SLLILVLCFLPLAALGK are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Bambusicola thoracica | Chinese bamboo-partridge | ACL81751 |
9083 |
| Francolinus pondicerianus interpositus | Francolinus pondicerianus interpositus | ACL81753 |
588856 |
| Gallus gallus | Chicken | AAD10202 1LSY_A ACL81619 ACL81573 ACL81571 P00698 NP_990612 |
9031 |
| Gallus lafayetii | Ceylon junglefowl | P00698 |
9032 |
| Gallus sonneratii | Gray junglefowl | P00698 |
9033 |
| Gallus varius | Green junglefowl | ACL81755 |
9034 |
| Meleagris gallopavo | Turkey | XP_003202118 |
9103 |
| Tympanuchus cupido | Greater prairie chicken | ANZ02901 |
9004 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.