Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
MRSLLILVLCFLPLAALGKVFGRCELAAAMKRHGLDNYRGYSLGNWVCAAKFESNFNTQATNRNTDGSTDYGILQINSRWWCNDGRTPGSRNLCNIPCSALLSSDITASVNCAKKIVSDGNGMNAWVAWRNRCKGTDVQAWIRGCRL
Species containing the peptide WWCNDGR are presented below. Accessions and taxid values link to further information hosted on NCBI.
Species name | Common name | Accession(s) | Tax ID |
---|---|---|---|
Bos grunniens | Domestic yak | AMR70501 |
30521 |
Callipepla californica | California quail | P00699 |
67771 |
Apteryx australis mantelli | Apteryx australis mantelli | XP_013802732 XP_013802731 XP_013802729 |
202946 |
Francolinus pondicerianus interpositus | Francolinus pondicerianus interpositus | ACL81753 |
588856 |
Catreus wallichii | Cheer pheasant | Q7LZP9 |
9085 |
Chrysolophus amherstiae | Lady amherst's pheasant | P22910 |
9088 |
Chrysolophus pictus | Golden pheasant | P22910 |
9089 |
Coturnix japonica | Japanese quail | 2IHL_A XP_015711651 P00701 |
93934 |
Dromaius novaehollandiae | Emu | G3XDT7 |
8790 |
Gallus gallus | Chicken | 3ZVQ_A 1UIA_A 5HMV_A 1V7S_A 1NDG_C 1H6M_A 1LSN_A 1UIC_A 1IR9_A 630460A 1UIE_A 1FLW_A 1NBY_C 1FLY_A 1AT5_A 1AT6_A 1IOS_A 1HEP_A 1IR8_A 1KXY_A 1FLQ_A 1IOQ_A 1FN5_A 1KXW_A 1IOT_A 1A2Y_C 1HER_A 1HEO_A 1HEQ_A 1HEN_A 1IOR_A 1NBZ_C 3WW6_A 3WW5_A 3WVX_A 4YEO_A 4N0J_A 3A3Q_A 1IR7_A 1FDL_Y 1IO5_A 1HEM_A 1UIF_A 1UID_A 1KXX_A 1LSM_A 3QY4_A 3OK0_A 3OJP_A 132L_A 4MWN_A 1LSG_A 1LSY_A ACL81619 ACL81573 ACL81571 P00698 NP_990612 |
9031 |
Gallus lafayetii | Ceylon junglefowl | P00698 |
9032 |
Gallus sonneratii | Gray junglefowl | P00698 |
9033 |
Heterotilapia buttikoferi | Heterotilapia buttikoferi | BAV13230 |
158773 |
Lophophorus impejanus | Lophophorus impejanus | Q7LZP9 |
9040 |
Meleagris gallopavo | Turkey | 1DZB_X XP_003202118 |
9103 |
Numida meleagris | Helmeted guineafowl | P00704 1HHL_A |
8996 |
Oreochromis niloticus | Nile tilapia | BAV13222 |
8128 |
Ortalis vetula | Plain chachalaca | P00707 |
8984 |
Pavo cristatus | Indian peafowl | P19849 |
9049 |
Phasianus colchicus | Ring-necked pheasant | 1JHL_A 1GHL_A LZFER |
9054 |
Phasianus colchicus colchicus | Ring-necked pheasant | P00702 |
9057 |
Phasianus versicolor | Green pheasant | P49663 |
9055 |
Struthio camelus | African ostrich | XP_009670021 |
8801 |
Struthio camelus australis | Struthio camelus australis | XP_009670021 |
441894 |
Syrmaticus reevesii | Reeves's pheasant | P24533 |
9066 |
Syrmaticus soemmerringii | Copper pheasant | P81711 2011187A |
9067 |
Tinamus guttatus | Tinamus guttatus | XP_010209345 |
94827 |
Tragopan satyra | Tragopan satyra | Q7LZI3 |
9070 |
Tragopan temminckii | Tragopan temminckii | Q7LZT2 |
9071 |
Xenopus (Silurana) tropicalis | Western clawed frog | OCA20585 NP_001011312 |
8364 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.