Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
MADRPQQLQVHPQRGHGHYEGGIKNQRGGGPSAVKVMAVLAALPVGGTLLALAGLTLAGSVIGLLVTSPLFIIFSPVLVPAAIVVGLAVASFLSSGALGLTGLSSLSWVLNYLRCASQSLPREMDQAKRRMQDMAAFVGQKTREVGQEIQSRAQEGRRT
None.
Species containing the peptide CASQSLPR are presented below. Accessions and taxid values link to further information hosted on NCBI.
Species name | Common name | Accession(s) | Tax ID |
---|---|---|---|
Corylus avellana | Corylus avellana | AAO67349 |
13451 |
Cupressus sempervirens | Cupressus sempervirens | ACJ09660 |
13469 |
Monomorium pharaonis | Pharaoh ant | XP_012535843 |
307658 |
Rattus norvegicus | Norway rat | NP_001162607 XP_006227981 |
10116 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.