Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
MADRPQQLQVHPQRGHGHYEGGIKNQRGGGPSAVKVMAVLAALPVGGTLLALAGLTLAGSVIGLLVTSPLFIIFSPVLVPAAIVVGLAVASFLSSGALGLTGLSSLSWVLNYLRCASQSLPREMDQAKRRMQDMAAFVGQKTREVGQEIQSRAQEGRRT
None.
Species containing the peptide GGGPSAVK are presented below. Accessions and taxid values link to further information hosted on NCBI.
Species name | Common name | Accession(s) | Tax ID |
---|---|---|---|
Corylus avellana | Corylus avellana | AAO67349 |
13451 |
Cupressus sempervirens | Cupressus sempervirens | ACJ09660 |
13469 |
Falco cherrug | Saker falcon | XP_014132597 XP_014132594 XP_014132593 XP_014132592 XP_014132591 |
345164 |
Falco peregrinus | Peregrine falcon | XP_013159114 XP_013159111 XP_013159110 XP_013159109 XP_013159108 XP_013159107 |
8954 |
Leishmania braziliensis MHOM/BR/75/M2904 | Leishmania braziliensis mhom/br/75/m2904 | XP_001564183 |
420245 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.