Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
MARLATLAALFAALLLVAHAAAFRTTITTVDVDEDIVNQQGRRGESCREQAQRQQNLNQCQRYMRQQSQYGSYDGSNQQQQQELEQCCQQLRQMDERCRCEGLRQAVMQQQGEMRGEEMREVMETARDLPNQCRLSPQRCEIRSARF
None.
Species containing the peptide EVMETAR are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Bactrocera oleae | Olive fruit fly | XP_014090864 |
104688 |
| Cladophialophora psammophila CBS 110553 | Cladophialophora psammophila cbs 110553 | XP_007749534 |
1182543 |
| Corylus avellana | Corylus avellana | ACO56333 |
13451 |
| Fundulus heteroclitus | Mummichog | XP_012725206 XP_012725205 |
8078 |
| Neodiprion lecontei | Redheaded pine sawfly | XP_015516353 |
441921 |
| Ophiocordyceps unilateralis | Ophiocordyceps unilateralis | KOM23148 |
268505 |
| Pyrenochaeta sp. DS3sAY3a | Pyrenochaeta sp. ds3say3a | OAL56973 |
765867 |
| Synechococcus phage S-CRM01 | Synechococcus phage s-crm01 | YP_004508661 |
1026955 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.