Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
MGSLKLVCAVLLCMMVAAPVARASLTCPQIKGNLTPCVLYLKNGGVLPPSCCKGVRAVNDASRTTSDRQSACNCLKDTAKGIAGLNPNLAAGLPGKCGVNIPYKISPSTNCNNVK
None.
Species containing the peptide AVNDASR are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Brassica rapa | Field mustard | XP_009143026 XP_009143025 |
3711 |
| Acromyrmex echinatior | Panamanian leafcutter ant | XP_011062445 EGI60624 |
103372 |
| Aphanomyces astaci | Aphanomyces astaci | XP_009839165 |
112090 |
| Arabidopsis lyrata subsp. lyrata | Arabidopsis lyrata subsp. lyrata | XP_002880113 |
81972 |
| Boea hygrometrica | Boea hygrometrica | KZV17352 KZV17349 |
472368 |
| Brassica napus | Rape | XP_013739336 XP_013688621 XP_013634136 CDY17847 CDX79758 |
3708 |
| Brassica oleracea var. oleracea | Brassica oleracea var. oleracea | XP_013634136 |
109376 |
| Chlorella variabilis | Chlorella variabilis | XP_005849468 |
554065 |
| Corylus avellana | Corylus avellana | 4XUW_A AAK28533 |
13451 |
| Cyphomyrmex costatus | Cyphomyrmex costatus | KYM99187 |
456900 |
| Didymella rabiei | Didymella rabiei | KZM28108 |
5454 |
| Drosophila kikkawai | Drosophila kikkawai | XP_017026867 |
30033 |
| Exaiptasia pallida | Exaiptasia pallida | KXJ18631 |
1720309 |
| Fibulorhizoctonia sp. CBS 109695 | Fibulorhizoctonia sp. cbs 109695 | KZP23186 |
436010 |
| Gallid herpesvirus 2 | Gallid herpesvirus 2 | AAF66770 |
10390 |
| Harpegnathos saltator | Jerdon's jumping ant | XP_011151749 |
610380 |
| Hypholoma sublateritium FD-334 SS-4 | Hypholoma sublateritium fd-334 ss-4 | KJA26117 |
945553 |
| Inonotus baumii | Inonotus baumii | OCB91917 |
108892 |
| Monomorium pharaonis | Pharaoh ant | XP_012521979 |
307658 |
| Monosiga brevicollis MX1 | Monosiga brevicollis mx1 | XP_001744489 |
431895 |
| Punctularia strigosozonata HHB-11173 SS5 | Punctularia strigosozonata hhb-11173 ss5 | XP_007381388 |
741275 |
| Ricinus communis | Castor bean | EEF24573 |
3988 |
| Solenopsis invicta | Red fire ant | XP_011159735 |
13686 |
| Trachymyrmex cornetzi | Trachymyrmex cornetzi | KYN22178 |
471704 |
| Trachymyrmex septentrionalis | Trachymyrmex septentrionalis | KYN37163 |
34720 |
| Vitrella brassicaformis CCMP3155 | Vitrella brassicaformis ccmp3155 | CEM21717 |
1169540 |
| Vollenhovia emeryi | Vollenhovia emeryi | XP_011881910 |
411798 |
| Zymoseptoria tritici IPO323 | Zymoseptoria tritici ipo323 | XP_003855116 |
336722 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.