Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
MMSFVSLLLVGILFHATQAEQLTKCEVFRELKDLKGYGGVSLPEWVCTTFHTSGYDTQAIVQNNDSTEYGLFQINNKIWCKDDQNPHSSNICNISCDKFLDDDLTDDIMCVKKILDKVGINYWLAHKALCSEKLDQWLCEKL
Species containing the peptide VGINYWLAHK are presented below. Accessions and taxid values link to further information hosted on NCBI.
Species name | Common name | Accession(s) | Tax ID |
---|---|---|---|
Balaenoptera acutorostrata scammoni | Balaenoptera acutorostrata scammoni | XP_007179325 |
310752 |
Bison bison bison | Bison | NP_776803 |
43346 |
Bos grunniens | Domestic yak | NP_776803 Q9TSR4 AER42591 |
30521 |
Bos indicus | Zebu (humped cattle) | LABOZ AAF06794 ABW77760 |
9915 |
Bos mutus | Wild yak | NP_776803 |
72004 |
Bos taurus | Cattle | 1F6R_A CAA44927 1HFZ_A NP_776803 AAF63624 AEV46829 |
9913 |
Bubalus bubalis | Water buffalo | AGG10763 AAF06794 Q9TSN6 NP_001277865 |
89462 |
Capra hircus | Goat | 1HFY_A 3B0K_A 1FKV_A 1HMK_A 1FKQ_A NP_001272564 |
9925 |
Cervus elaphus xanthopygus | Manchurian wapiti | AAF06795 |
9865 |
Lipotes vexillifer | Yangtze river dolphin | XP_007452290 |
118797 |
Orcinus orca | Killer whale | XP_004274443 |
9733 |
Ovis aries | Sheep | P09462 NP_001009797 |
9940 |
Pantholops hodgsonii | Chiru | XP_005981064 |
59538 |
Physeter catodon | Sperm whale | XP_007107591 |
9755 |
Tursiops truncatus | Bottlenosed dolphin | XP_004324918 |
9739 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.