Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
MKCLLLALALTCGAQALIVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQKWENGECAQKKIIAEKTKIPAVFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLACQCLVRTPEVDDEALEKFDKALKALPMHIRLSFNPTQLEEQCHI
None.
Species containing the peptide CLLLALALTCGAQALIVTQTMK are presented below. Accessions and taxid values link to further information hosted on NCBI.
Species name | Common name | Accession(s) | Tax ID |
---|---|---|---|
Bos mutus | Wild yak | XP_014336945 XP_005888577 |
72004 |
Bison bison bison | Bison | XP_010855058 |
43346 |
Bos taurus | Cattle | ALC76015 NP_776354 ACG59280 CAA32835 XP_015329083 |
9913 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.