Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
MKCLLLALALTCGAQALIVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQKWENGECAQKKIIAEKTKIPAVFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLACQCLVRTPEVDDEALEKFDKALKALPMHIRLSFNPTQLEEQCHI
Species containing the peptide IDALNENK are presented below. Accessions and taxid values link to further information hosted on NCBI.
Species name | Common name | Accession(s) | Tax ID |
---|---|---|---|
Rangifer tarandus | Reindeer | 1YUP_A |
9870 |
Bison bison bison | Bison | XP_010855058 |
43346 |
Bos grunniens | Domestic yak | AFB74992 AFB74990 |
30521 |
Bos mutus | Wild yak | XP_005888577 |
72004 |
Bos taurus | Cattle | AAA30411 3PH5_A 5HTD_A 1UZ2_X 1BSQ_A 1DV9_A 1BSO_A 1BEB_A 5K06_A NP_776354 ACG59280 CAA32835 XP_015329083 |
9913 |
Bovine viral diarrhea virus 1 | Bovine viral diarrhea virus 1 | AKF02743 |
11099 |
Bubalus bubalis | Water buffalo | 0601265A ABG78270 P02755 NP_001277893 |
89462 |
Capra hircus | Goat | 4TLJ_A ABQ51182 NP_001272468 |
9925 |
Ovis aries | Sheep | CAA30059 4CK4_A 4NLI_A 4CK4_B NP_001009366 |
9940 |
Ovis aries musimon | Mouflon | P67975 |
9938 |
Ovis sp. | Sheep | AAA31510 |
9939 |
Pantholops hodgsonii | Chiru | XP_005963286 |
59538 |
Polistes canadensis | Polistes canadensis | XP_014604098 XP_014604097 |
91411 |
Rangifer tarandus tarandus | Reindeer | AAZ57420 |
86329 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.