Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
MKCLLLALALTCGAQALIVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQKWENGECAQKKIIAEKTKIPAVFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLACQCLVRTPEVDDEALEKFDKALKALPMHIRLSFNPTQLEEQCHI
Species containing the peptide TPEVDDEALEK are presented below. Accessions and taxid values link to further information hosted on NCBI.
Species name | Common name | Accession(s) | Tax ID |
---|---|---|---|
Bison bison bison | Bison | XP_010855058 |
43346 |
Bos mutus | Wild yak | XP_005888577 |
72004 |
Bos taurus | Cattle | AAA30412 AAA30411 3PH5_A 5HTD_A 1UZ2_X 1BSQ_A 732164A 1DV9_A 1BSO_A 1BEB_A 5K06_A NP_776354 ACG59280 CAA32835 XP_015329083 |
9913 |
Bubalus bubalis | Water buffalo | 0601265A ABG78270 P02755 NP_001277893 |
89462 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.