Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
MKCLLLALALTCGAQALIVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQKWENGECAQKKIIAEKTKIPAVFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLACQCLVRTPEVDDEALEKFDKALKALPMHIRLSFNPTQLEEQCHI
Species containing the peptide VYVEELKPTPEGDLEILLQK are presented below. Accessions and taxid values link to further information hosted on NCBI.
Species name | Common name | Accession(s) | Tax ID |
---|---|---|---|
Bison bison bison | Bison | XP_010855238 |
43346 |
Bos grunniens | Domestic yak | AFB74992 AFB74990 |
30521 |
Bos mutus | Wild yak | ELR61650 XP_014336945 XP_005888596 XP_005888577 |
72004 |
Bos taurus | Cattle | AAA30411 3PH5_A 5HTD_A 1UZ2_X 1BSQ_A 732164A 1DV9_A 1BSO_A 1BEB_A 5K06_A NP_776354 ACG59280 CAA32835 XP_015329083 |
9913 |
Bubalus bubalis | Water buffalo | 0601265A ABG78270 P02755 NP_001277893 XP_006062280 |
89462 |
Capra hircus | Goat | XP_017910230 |
9925 |
Pantholops hodgsonii | Chiru | XP_005963296 |
59538 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.