Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
PAGPFRIPKCRKEFQQAQHLRACQQWLHKQAMQSGSGPSWTLDDEFDFEDDMENPQGPQQRPPLLQQCCNELHQEEPLCVCPTLKGASKAVKQQVRQQLGQQGQQGPHLQHVISRIYQTATHLPKVCNIRQVSVCPFKKTMPGPS
Species containing the peptide IYQTATHLPK are presented below. Accessions and taxid values link to further information hosted on NCBI.
Species name | Common name | Accession(s) | Tax ID |
---|---|---|---|
Brassica carinata | Brassica carinata | CAA52813 |
52824 |
Brassica juncea | Brassica juncea | CAA46785 |
3707 |
Brassica napus | Rape | AAB37413 AAB37416 P80208 P01091 CDX89275 CDX89273 CDX89271 CDY29278 CDY29280 AAA33006 XP_013688210 XP_013743463 P01090 P27740 XP_009143159 XP_009145761 XP_013741658 XP_013592507 XP_009143128 XP_013746924 |
3708 |
Brassica napus var. napus | Brassica napus var. napus | AAS68181 AAS68184 XP_013592507 |
138011 |
Brassica oleracea | Brassica oleracea | CAA46783 |
3712 |
Brassica oleracea var. oleracea | Brassica oleracea var. oleracea | XP_013621452 XP_013592507 |
109376 |
Brassica rapa | Field mustard | XP_009143159 XP_009145761 XP_009143128 XP_009143149 XP_009143171 |
3711 |
Sinapis alba | White mustard | P15322 CAA62911 CAA62910 CAA62908 CAA62912 |
3728 |
Sinapis arvensis | Sinapis arvensis | P38057 |
29728 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.