Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
ALSCGTVNSNLAACIGYLTQNAPLPKGCCTGVTNLNNMARTTPDRQQACRCLVGAANSFPSLNAARAAALPKACGVNIPYKISKSTNCNSVR
None.
Species containing the peptide ACGVNIPYK are presented below. Accessions and taxid values link to further information hosted on NCBI.
Species name | Common name | Accession(s) | Tax ID |
---|---|---|---|
Arabidopsis lyrata subsp. lyrata | Arabidopsis lyrata subsp. lyrata | XP_002879751 |
81972 |
Arabidopsis thaliana | Thale cress | NP_181388 |
3702 |
Brassica napus | Rape | AAB33170 AAB33172 AAB33171 Q42616 Q42615 XP_009141748 Q42614 Q42642 XP_009141746 XP_013706999 XP_009143379 CAB53447 CDX91474 |
3708 |
Brassica oleracea | Brassica oleracea | XP_013630892 |
3712 |
Brassica oleracea var. italica | Brassica oleracea var. italica | Q42642 XP_013630892 |
36774 |
Brassica oleracea var. oleracea | Brassica oleracea var. oleracea | XP_013632122 XP_013630892 |
109376 |
Brassica rapa | Field mustard | XP_009141748 XP_009141746 XP_009143379 |
3711 |
Brassica rapa subsp. pekinensis | Chinese cabbage | XP_009141746 XP_009143379 |
51351 |
Camelina sativa | Camelina sativa | XP_010505481 XP_010517150 XP_010517149 XP_010509135 |
90675 |
Capsella rubella | Capsella rubella | XP_006295253 XP_006295252 |
81985 |
Capsicum annuum | Capsicum annuum | XP_016567772 XP_016545932 XP_016545892 XP_016544755 XP_016543253 AAR83849 |
4072 |
Nicotiana sylvestris | Wood tobacco | XP_009797053 XP_009797052 XP_009764784 XP_009757911 XP_009757912 |
4096 |
Nicotiana tabacum | Common tobacco | XP_016433631 XP_016445760 XP_009797052 XP_009764784 Q03461 XP_009757911 XP_016433627 |
4097 |
Nicotiana tomentosiformis | Nicotiana tomentosiformis | XP_009592587 XP_009592579 XP_009592571 |
4098 |
Sinapis alba | White mustard | ABU95411 AFM39014 |
3728 |
Solanum tuberosum | Potato | XP_006355280 XP_006355279 XP_006355281 |
4113 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.