Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
ALSCGTVNSNLAACIGYLTQNAPLPKGCCTGVTNLNNMARTTPDRQQACRCLVGAANSFPSLNAARAAALPKACGVNIPYKISKSTNCNSVR
None.
Species containing the peptide GCCTGVTNLNNMAR are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Brassica napus | Rape | AAB33170 Q42615 XP_009141748 Q42614 Q42642 XP_009141746 |
3708 |
| Brassica oleracea var. italica | Brassica oleracea var. italica | Q42642 |
36774 |
| Brassica oleracea var. oleracea | Brassica oleracea var. oleracea | XP_013632122 |
109376 |
| Brassica rapa | Field mustard | XP_009141748 XP_009141746 |
3711 |
| Brassica rapa subsp. pekinensis | Chinese cabbage | AAM64220 XP_009141746 |
51351 |
| Sinapis alba | White mustard | ABU95411 |
3728 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.