Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
MSWQTYVDDHLMCDVEGNRLTAAAILGQDGSVWAQSANFPQLKPEEIKGINNDFAEPGTLAPTGLFIGGTKYMVIQGEPNAVIRGKKGAGGVTIKKTTQAFVFGIYEEPMTPGQCNMVVERLGDYLIEQGL
None.
Species containing the peptide MSWQTYVDDHLMCDVEGNR are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Arabidopsis lyrata subsp. lyrata | Arabidopsis lyrata subsp. lyrata | XP_002866157 |
81972 |
| Arabis alpina | Gray rockcress | KFK27226 |
50452 |
| Brassica napus | Rape | XP_013666995 CDY32870 XP_013729132 |
3708 |
| Brassica oleracea var. oleracea | Brassica oleracea var. oleracea | XP_013612142 |
109376 |
| Brassica rapa | Field mustard | XP_009120170 |
3711 |
| Brassica rapa subsp. pekinensis | Chinese cabbage | AHB33797 |
51351 |
| Camelina sativa | Camelina sativa | XP_010483134 |
90675 |
| Sinapis alba | White mustard | ABU95412 |
3728 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.