Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
MAKLTILVALALFLLAAHASARQQWELQGDRRCQSQLERANLRPCEQHLMQKIQRDEDSYGRDPYSPSQDPYSPSPYDRRGAGSSQHQERCCNELNEFENNQRCMCEALQQIMENQSDRLQGRQQEQQFKRELRNLPQQCGLRAPQRCDLEVESGGRDRY
MAKLTILVALALFLLAAHASARQQWELQGDRRCQSQLERANLRPCEQHLMQKIQRDEDSYGRDPYSPSQDPYSPSQDPDRRDPYSPSPYDRRGAGSSQHQERCCNELNEFENNQRCMCEALQQIMENQSDRLQGRQQEQQFKRELRNLPQQCGLRAPQRCDLEVESGGRDRY
Species containing the peptide DPYSPSQDPYSPSPYDR are presented below. Accessions and taxid values link to further information hosted on NCBI.
Species name | Common name | Accession(s) | Tax ID |
---|---|---|---|
Arachis duranensis | Peanut ancestor | XP_015936509 ABW36075 ABW36073 ABW36072 |
130453 |
Arachis hypogaea | Peanut | AAK96887 ACN62248 AAT00599 AAU21494 |
3818 |
Arachis ipaensis | Arachis ipaensis | XP_016170467 |
130454 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.