Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
MGVFTFEDEITSTVPPAKLYNAMKDADSITPKIIDDVKSVEIVEGNGGPGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY
MGVHTFEEESTSPVPPAKLFKATVVDGDELTPKLIPAIQSIEIVEGNGGPGTVKKVTAVEDGKTSYVLHKIDAIDEATYTYDYTISGGTGFQEILEKVSFKTKLEAADGGSKIKVSVTFHTKGDAPLPDEVHQDVKQKSQGIFKAIEGYVLSN
None.
Species containing the peptide AIEGYVLANPTQY are presented below. Accessions and taxid values link to further information hosted on NCBI.
Species name | Common name | Accession(s) | Tax ID |
---|---|---|---|
Arachis duranensis | Peanut ancestor | XP_015936693 XP_015936682 |
130453 |
Arachis hypogaea | Peanut | 4M9B_A ACA79908 ABG85155 |
3818 |
Arachis ipaensis | Arachis ipaensis | XP_016198546 XP_016198480 |
130454 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.