Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
MGVFTFEDEITSTVPPAKLYNAMKDADSITPKIIDDVKSVEIVEGNGGPGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY
MGVHTFEEESTSPVPPAKLFKATVVDGDELTPKLIPAIQSIEIVEGNGGPGTVKKVTAVEDGKTSYVLHKIDAIDEATYTYDYTISGGTGFQEILEKVSFKTKLEAADGGSKIKVSVTFHTKGDAPLPDEVHQDVKQKSQGIFKAIEGYVLSN
None.
Species containing the peptide LVEGPNGGSIGK are presented below. Accessions and taxid values link to further information hosted on NCBI.
Species name | Common name | Accession(s) | Tax ID |
---|---|---|---|
Arachis duranensis | Peanut ancestor | XP_015937483 XP_015937471 XP_015936682 XP_015936667 |
130453 |
Arachis hypogaea | Peanut | CAJ43118 4M9B_A ACD39391 ACA79908 |
3818 |
Arachis ipaensis | Arachis ipaensis | XP_016198546 XP_016198522 XP_016198512 XP_016198501 XP_016198480 XP_016198467 XP_016198455 XP_016197800 XP_016197791 XP_015936667 XP_016172653 |
130454 |
Trifolium subterraneum | Trifolium subterraneum | GAU37480 GAU37479 GAU37476 GAU37475 |
3900 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.