If you found this site useful, please cite:

Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.

  1. Home
  2. Peanut
  3. Ara h 9

Peanut Protein: Ara h 9 | Nonspecific Lipid-Transfer Protein 1

Isoform:

Empirical Proteotypic Peptide Explorer:

This rose plot enables visualization of proteotypic peptides. Each colored rose petal corresponds to a peptide and is bounded by thin gray petals, which represent tryptic cut sites. The radial magnitude of each peptide corresponds to the number of publications which report it.

Hover over a rose petal with your mouse to see the peptide. Click on a rose petal to see the species specificity of that peptide and add it to your cart.


Sequence - 116 amino acids

MASLKFAFVMLVCMAMVGAPMVNAISCGQVNSALAPCIPFLTKGGAPPPACCSGVRGLLGALRTTADRQAACNCLKAAAGSLRGLNQGNAAALPGRCGVSIPYKISTSTNCATIKF

UniProt: B6CEX8   IUIS: Ara h 9

Empirical Proteotypic Peptide Explorer:

This rose plot enables visualization of proteotypic peptides. Each colored rose petal corresponds to a peptide and is bounded by thin gray petals, which represent tryptic cut sites. The radial magnitude of each peptide corresponds to the number of publications which report it.

Hover over a rose petal with your mouse to see the peptide. Click on a rose petal to see the species specificity of that peptide and add it to your cart.


Sequence - 92 amino acids

LSCGQVNSALAPCITFLTKGGVPSGPCCSGVRGLLGAAKTTADRQAACNCLKAAAGSLHGLNQGNAAALPGRCGVSIPYKISTSTNCATIKF

UniProt: B6CG41   IUIS: Ara h 9

Peptide Selector Tool

Explore peptide targets for mass spectrometry by adjusting the selection criteria below. Results from empirical and computational prediction tools have been aggregated for convenience.

Exclude:
Peptide Characteristics:

Minimum length:

Maximum length:

1Peptide2Exp.3ESP4CONSeQ5
K GGAPPPACCSGVR G 0 0.478 0.38472
R GLLGALR T 0 0.234 0.44692
R QAACNCLK A 0 0.293 0.34346
K AAAGSLR G 0 0.216 0.15466
R GLNQGNAAALPGR C 0 0.655 0.70414
R CGVSIPYK I 0 0.274 0.46186
K ISTSTNCATIK F 0 0.398 0.4811
^ LSCGQVNSALAPCITFLTK G 0 0.601 0.1222
K GGVPSGPCCSGVR G 0 0.54 0.3636
R GLLGAAK T 0 0.203 0.33554
R QAACNCLK A 0 0.293 0.34346
K AAAGSLHGLNQGNAAALPGR C 0 0.715 0.66154
R CGVSIPYK I 0 0.274 0.46186
K ISTSTNCATIK F 0 0.398 0.4811

1 Previous amino acid (^ = Start of protein)

2 Next amino acid ($ = End of protein)

3 Exp. = Number of publications in which this peptide has been reported experimentally

4 ESP = ESP Predictor. Fusaro VA, et al. Nat Botechnol 2009; 27(2): 190-198. doi

5 CONSeQ = CONSeQuence. Eyers CE, et al. Mol Cell Proteomics 2011; 10(11). doi

Underline: Peptide occurs within the first 20 amino acids from the start of the protein. Use caution as the protein may contain a cleaved signaling sequence.

Strike-through: Peptide is present in a protein from another allergen species and is thus nonspecific.

 

  1. Home
  2. Peanut
  3. Ara h 9