Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
MASLKFAFVMLVCMAMVGAPMVNAISCGQVNSALAPCIPFLTKGGAPPPACCSGVRGLLGALRTTADRQAACNCLKAAAGSLRGLNQGNAAALPGRCGVSIPYKISTSTNCATIKF
LSCGQVNSALAPCITFLTKGGVPSGPCCSGVRGLLGAAKTTADRQAACNCLKAAAGSLHGLNQGNAAALPGRCGVSIPYKISTSTNCATIKF
None.
Species containing the peptide GLNQGNAAALPGR are presented below. Accessions and taxid values link to further information hosted on NCBI.
Species name | Common name | Accession(s) | Tax ID |
---|---|---|---|
Arachis diogoi | Arachis diogoi | ABY54820 |
170720 |
Arachis duranensis | Peanut ancestor | XP_015950567 |
130453 |
Arachis hypogaea | Peanut | ABX75045 ABX56711 |
3818 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.