Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
MASLKFAFVMLVCMAMVGAPMVNAISCGQVNSALAPCIPFLTKGGAPPPACCSGVRGLLGALRTTADRQAACNCLKAAAGSLRGLNQGNAAALPGRCGVSIPYKISTSTNCATIKF
LSCGQVNSALAPCITFLTKGGVPSGPCCSGVRGLLGAAKTTADRQAACNCLKAAAGSLHGLNQGNAAALPGRCGVSIPYKISTSTNCATIKF
None.
Species containing the peptide ISTSTNCATIK are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Arabidopsis lyrata subsp. lyrata | Arabidopsis lyrata subsp. lyrata | XP_002866326 XP_002866326 |
81972 |
| Arabidopsis thaliana | Thale cress | NP_568904 NP_568904 |
3702 |
| Arachis diogoi | Arachis diogoi | ACA58358 ABY54820 ACA58358 ABY54820 |
170720 |
| Arachis duranensis | Peanut ancestor | XP_015950567 XP_015950567 |
130453 |
| Arachis hypogaea | Peanut | ABX75045 ABX56711 ABX75045 ABX56711 |
3818 |
| Camelina sativa | Camelina sativa | XP_010483549 XP_010443684 XP_010443683 XP_010454869 XP_010454858 XP_010483549 XP_010443684 XP_010443683 XP_010454869 XP_010454858 |
90675 |
| Capsella rubella | Capsella rubella | XP_006281350 XP_006281283 XP_006281350 XP_006281283 |
81985 |
| Glycine max | Soybean | KRH76117 NP_001240073 NP_001241144 KRH76117 NP_001240073 NP_001241144 |
3847 |
| Glycine soja | Glycine soja | ACZ06858 ACZ06858 |
3848 |
| Phaseolus vulgaris | Phaseolus vulgaris | AAC49860 XP_007134701 XP_007134674 AAC49860 XP_007134701 XP_007134674 |
3885 |
| Trifolium subterraneum | Trifolium subterraneum | GAU30834 GAU30834 |
3900 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.