Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
This rose plot enables visualization of proteotypic peptides. Each colored rose petal corresponds to a peptide and is bounded by thin gray petals, which represent tryptic cut sites. The radial magnitude of each peptide corresponds to the number of publications which report it.
Hover over a rose petal with your mouse to see the peptide. Click on a rose petal to see the species specificity of that peptide and add it to your cart.
MALLSYVTRKTLTESLRLGLKSHVRGLQTFTLPDLPYEYGALEPAISSEIMQLHHQKHHQTYITNYNKALEQLDQAINKGDASAVVKLQSAIKFNGGGHINHSIFWKNLTPVSEGGGEPPHGSLGWAIDTNFGSMEALIQRMNAEGAALQGSGWVWLGLDKESKKLVVETTANQDPLVTKGPSLVPLLGIDVWEHAYYLQYKNVRPDYLKNIWKVINWKYAGELYQKECP
UniProt: B2BDZ8 IUIS: Pis v 4Explore peptide targets for mass spectrometry by adjusting the selection criteria below. Results from empirical and computational prediction tools have been aggregated for convenience.
1 | Peptide | 2 | Exp.3 | ESP4 | CONSeQ5 |
---|---|---|---|---|---|
^ | MALLSYVTR | K | 0 | 0.335 | 0.31202 |
K | TLTESLR | L | 0 | 0.264 | 0.28638 |
K | HHQTYITNYNK | A | 0 | 0.49 | 0.17482 |
K | ALEQLDQAINK | G | 0 | 0.508 | 0.76594 |
K | GDASAVVK | L | 0 | 0.268 | 0.26582 |
K | FNGGGHINHSIFWK | N | 0 | 0.545 | 0.24338 |
R | MNAEGAALQGSGWVWLGLDK | E | 0 | 0.432 | 0.10018 |
K | LVVETTANQDPLVTK | G | 0 | 0.853 | 0.8966 |
K | GPSLVPLLGIDVWEHAYYLQYK | N | 0 | 0.541 | 0.06738 |
K | NVRPDYLK | N | 0 | 0.224 | 0.42406 |
K | YAGELYQK | E | 0 | 0.251 | 0.36132 |
1 Previous amino acid (^ = Start of protein)
2 Next amino acid ($ = End of protein)
3 Exp. = Number of publications in which this peptide has been reported experimentally
4 ESP = ESP Predictor. Fusaro VA, et al. Nat Botechnol 2009; 27(2): 190-198. doi
5 CONSeQ = CONSeQuence. Eyers CE, et al. Mol Cell Proteomics 2011; 10(11). doi
Underline: Peptide occurs within the first 20 amino acids from the start of the protein. Use caution as the protein may contain a cleaved signaling sequence.
Strike-through: Peptide is present in a protein from another allergen species and is thus nonspecific.