Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
MALLSYVTRKTLTESLRLGLKSHVRGLQTFTLPDLPYEYGALEPAISSEIMQLHHQKHHQTYITNYNKALEQLDQAINKGDASAVVKLQSAIKFNGGGHINHSIFWKNLTPVSEGGGEPPHGSLGWAIDTNFGSMEALIQRMNAEGAALQGSGWVWLGLDKESKKLVVETTANQDPLVTKGPSLVPLLGIDVWEHAYYLQYKNVRPDYLKNIWKVINWKYAGELYQKECP
None.
Species containing the peptide GPSLVPLLGIDVWEHAYYLQYK are presented below. Accessions and taxid values link to further information hosted on NCBI.
Species name | Common name | Accession(s) | Tax ID |
---|---|---|---|
Acanthus ebracteatus | Acanthus ebracteatus | ABK32075 |
241842 |
Avicennia marina | Avicennia marina | AAN15216 |
82927 |
Boea hygrometrica | Boea hygrometrica | KZV34922 |
472368 |
Cicer arietinum | Chickpea | XP_004502849 |
3827 |
Litchi chinensis | Litchi chinensis | AGA16522 AEK05514 |
151069 |
Pistacia vera | Pistacia vera | ABR29644 |
55513 |
Salicornia europaea | Salicornia europaea | AFD50703 |
206448 |
Trifolium repens | White clover | AFV96160 |
3899 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.