Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
MALLSYVTRKTLTESLRLGLKSHVRGLQTFTLPDLPYEYGALEPAISSEIMQLHHQKHHQTYITNYNKALEQLDQAINKGDASAVVKLQSAIKFNGGGHINHSIFWKNLTPVSEGGGEPPHGSLGWAIDTNFGSMEALIQRMNAEGAALQGSGWVWLGLDKESKKLVVETTANQDPLVTKGPSLVPLLGIDVWEHAYYLQYKNVRPDYLKNIWKVINWKYAGELYQKECP
None.
Species containing the peptide MNAEGAALQGSGWVWLGLDK are presented below. Accessions and taxid values link to further information hosted on NCBI.
Species name | Common name | Accession(s) | Tax ID |
---|---|---|---|
Gossypium arboreum | Gossypium arboreum | XP_016686329 |
29729 |
Gossypium hirsutum | Upland cotton | XP_016686843 XP_016686329 |
3635 |
Capsicum annuum | Capsicum annuum | NP_001311927 |
4072 |
Cinnamomum camphora | Camphor tree | AAC35356 |
13429 |
Daucus carota subsp. sativus | Daucus carota subsp. sativus | KZN01718 XP_017243111 XP_017253701 |
79200 |
Eucalyptus grandis | Eucalyptus grandis | XP_010031093 |
71139 |
Eutrema halophilum | Eutrema halophilum | XP_006407489 ABL75952 |
98038 |
Eutrema salsugineum | Eutrema salsugineum | XP_006407489 |
72664 |
Gossypium raimondii | Gossypium raimondii | KJB60199 XP_012447071 |
29730 |
Mimulus guttatus | Spotted monkey flower | XP_012858324 |
4155 |
Pistacia vera | Pistacia vera | ABR29644 |
55513 |
Rheum australe | Rheum australe | ABI35908 |
284363 |
Sesamum indicum | Sesame | XP_011076593 |
4182 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.