If you found this site useful, please cite:

Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.

Peptide: GCEWESR

Peptide within the protein Ses-i-2:

MARFTIVLAVLFAAALVSASAHKTVVTTSVAEEGEEENQRGCEWESRQCQMRHCMQWMRSMRGQYEESFLRSAEANQGQFEHFRECCNELRDVKSHCRCEALRCMMRQMQQEYGMEQEMQQMQQMMQYLPRMCGMSYPTECRMRPIFA

References reporting this peptide:

None.


Species Uniqueness

Species containing the peptide GCEWESR are presented below. Accessions and taxid values link to further information hosted on NCBI.

Species name Common name Accession(s) Tax ID
Sesamum indicum Sesame B3EWE9
XP_011095387
4182

BLAST non-redundant protein database version: 4, date: December 9, 2015.

See the About page for more information.