Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
MARFTIVLAVLFAAALVSASAHKTVVTTSVAEEGEEENQRGCEWESRQCQMRHCMQWMRSMRGQYEESFLRSAEANQGQFEHFRECCNELRDVKSHCRCEALRCMMRQMQQEYGMEQEMQQMQQMMQYLPRMCGMSYPTECRMRPIFA
None.
Species containing the peptide HCMQWMR are presented below. Accessions and taxid values link to further information hosted on NCBI.
Species name | Common name | Accession(s) | Tax ID |
---|---|---|---|
Chrysochromulina sp. CCMP291 | Chrysochromulina sp. ccmp291 | KOO22206 |
1460289 |
Neonectria ditissima | Neonectria ditissima | KPM44238 |
78410 |
Sesamum indicum | Sesame | XP_011095387 ABB60053 XP_011095337 |
4182 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.