Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
MARFTIVLAVLFAAALVSASAHKTVVTTSVAEEGEEENQRGCEWESRQCQMRHCMQWMRSMRGQYEESFLRSAEANQGQFEHFRECCNELRDVKSHCRCEALRCMMRQMQQEYGMEQEMQQMQQMMQYLPRMCGMSYPTECRMRPIFA
None.
Species containing the peptide TVVTTSVAEEGEEENQR are presented below. Accessions and taxid values link to further information hosted on NCBI.
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.