Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
MGVFTFEDEINSPVAPATLYKALVTDADNVIPKALDSFKSVENVEGNGGPGTIKKITFLEDGETKFVLHKIESIDEANLGYSYSVVGGAALPDTAEKITFDSKLVAGPNGGSAGKLTVKYETKGDAEPNQDELKTGKAKADALFKAIEAYLLAHPDYN
None.
Species containing the peptide SVENVEGNGGPGTIK are presented below. Accessions and taxid values link to further information hosted on NCBI.
Species name | Common name | Accession(s) | Tax ID |
---|---|---|---|
Carpinus betulus | European hornbeam | AAB34909 CAA47367 P38950 CAB02217 CAB02216 |
12990 |
Corylus avellana | Corylus avellana | CAA50328 Q08407 CAA96548 CAA50325 |
13451 |
Glycine max | Soybean | NP_001238060 KRH50780 2K7H_A KRH50783 NP_001236038 NP_001236562 NP_001238655 KRH50782 |
3847 |
Glycine soja | Glycine soja | NP_001236038 NP_001236562 NP_001238655 |
3848 |
Lupinus albus | White lupine | CAA03926 |
3870 |
Vigna unguiculata | Cowpea | CAA67200 |
3917 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.