If you found this site useful, please cite:

Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.

Peptide: AGDSDGDGK

Peptide within the protein Xip-g-1:

MAFAGVLSDADVAAALEACKDAGTFDYKKFFKSCGLAAKSTDDVKKAFAIIDQDKSGFIEEDELKLFLQNFKAAARPLTDAETEAFLKAGDSDGDGKIGAEEFAALVTA

References reporting this peptide:

None.


Species Uniqueness

Warning: nonspecific peptide


Species containing the peptide AGDSDGDGK are presented below. Accessions and taxid values link to further information hosted on NCBI.


BLAST non-redundant protein database version: 4, date: December 9, 2015.

See the About page for more information.