Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
MAFAGVLSDADVAAALEACKDAGTFDYKKFFKSCGLAAKSTDDVKKAFAIIDQDKSGFIEEDELKLFLQNFKAAARPLTDAETEAFLKAGDSDGDGKIGAEEFAALVTA
None.
Food | Protein | Taxid |
---|---|---|
Fish | Clu-h-1.0101 | 7950 |
Fish | Clu-h-1.0201 | 7950 |
Fish | Cyp-c-1.0201 | 7962 |
Fish | Lat-c-1.0201 | 8187 |
Fish | Xip-g-1.0101 | 8245 |
Species containing the peptide LFLQNFK are presented below. Accessions and taxid values link to further information hosted on NCBI.
Species name | Common name | Accession(s) | Tax ID |
---|
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.