Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
MAFAGVLSDADVAAALEACKDAGTFDYKKFFKSCGLAAKSTDDVKKAFAIIDQDKSGFIEEDELKLFLQNFKAAARPLTDAETEAFLKAGDSDGDGKIGAEEFAALVTA
None.
Species containing the peptide SCGLAAK are presented below. Accessions and taxid values link to further information hosted on NCBI.
Species name | Common name | Accession(s) | Tax ID |
---|---|---|---|
Glycine soja | Glycine soja | KHN09569 |
3848 |
Amphidinium carterae | Amphidinium carterae | ABF57014 |
2961 |
Brugia malayi | Brugia malayi | XP_001896251 XP_001902741 |
6279 |
Equus asinus | Ass | XP_014688818 XP_014688814 XP_014688813 |
9793 |
Glycine max | Soybean | NP_001236466 KHN09569 |
3847 |
Gymnopus luxurians FD-317 M1 | Gymnopus luxurians fd-317 m1 | KIK66359 |
944289 |
Kazachstania africana CBS 2517 | Kazachstania africana cbs 2517 | XP_003959871 |
1071382 |
Kazachstania naganishii CBS 8797 | Kazachstania naganishii cbs 8797 | CCK68727 |
1071383 |
Lachancea sp. KF-2015 | Lachancea sp. kf-2015 | CUS23098 |
1654605 |
Opisthorchis viverrini | Opisthorchis viverrini | XP_009174817 |
6198 |
Tetrapisispora blattae CBS 6284 | Tetrapisispora blattae cbs 6284 | XP_004181270 |
1071380 |
Tetrapisispora phaffii CBS 4417 | Tetrapisispora phaffii cbs 4417 | XP_003683826 |
1071381 |
Vigna angularis | Adzuki bean | XP_017437167 XP_017437164 |
3914 |
Vigna angularis var. angularis | Vigna angularis var. angularis | XP_017437164 |
157739 |
Xiphias gladius | Swordfish | CAR48256 |
8245 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.