Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
AALLVALLFVANAAAFRTTITTMEIDEDIDNPRRRGEGCREQIQRQQNLNHCQYYLRQQSRSGGYDEDNQRQHFRQCCQQLSQMDEQCQCEGLRQVVRRQQQQQGLRGEEMEEMVQSARDLPNECGISSQRCEIRRSWF
None.
Food | Protein | Taxid |
---|---|---|
Walnut | Jug-n-1.0101 | 16719 |
Walnut | Jug-r-1.0101 | 51240 |
Walnut | Jug-r-3.0101 | 51240 |
Species containing the peptide QQNLNHCQYYLR are presented below. Accessions and taxid values link to further information hosted on NCBI.
Species name | Common name | Accession(s) | Tax ID |
---|---|---|---|
Juglans nigra | Black walnut | AAM54365 AAM54365 AAM54365 |
16719 |
Juglans regia | English walnut | AAB41308 AAB41308 AAB41308 |
51240 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.