Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
ISCSQVDSTLMPCLQYVQQGGSPARGCCTGIQNLLAEANNSPDRRTICGCLKNVANGASGGPYITRAAALPSKCNVALPYKISPSVDCNTVH
None.
Species containing the peptide GCCTGIQNLLAEANNSPDR are presented below. Accessions and taxid values link to further information hosted on NCBI.
Species name | Common name | Accession(s) | Tax ID |
---|---|---|---|
Aegilops tauschii | Aegilops tauschii | CAH69197 |
37682 |
Triticum aestivum | Bread wheat | CAY54133 CAY54132 CAY54131 CAH69198 CAH69196 CAH04985 CAH69197 |
4565 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.