Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
ISCSQVDSTLMPCLQYVQQGGSPARGCCTGIQNLLAEANNSPDRRTICGCLKNVANGASGGPYITRAAALPSKCNVALPYKISPSVDCNTVH
None.
Species containing the peptide TICGCLK are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Aegilops tauschii | Aegilops tauschii | CAH69197 |
37682 |
| Brachypodium distachyon | Brachypodium distachyon | XP_003564507 |
15368 |
| Cimex lectularius | Bed bug | XP_014251435 XP_014251427 XP_014251417 XP_014251395 |
79782 |
| Dactylis glomerata | Orchard grass | ADD13588 |
4509 |
| Hordeum vulgare | Hordeum vulgare | AAF14232 |
4513 |
| Hordeum vulgare subsp. vulgare | Domesticated barley | AAF14232 |
112509 |
| Jatropha curcas | Jatropha curcas | XP_012081197 |
180498 |
| Oryza brachyantha | Malo sina | XP_006644921 |
4533 |
| Oryza sativa Indica Group | Long-grained rice | XP_015629722 |
39946 |
| Oryza sativa Japonica Group | Japanese rice | XP_015629722 |
39947 |
| Setaria italica | Foxtail millet | XP_004970395 |
4555 |
| Sorghum bicolor | Sorghum | XP_002458690 |
4558 |
| Stevia rebaudiana | Stevia rebaudiana | ABK28789 |
55670 |
| Triticum aestivum | Bread wheat | CAY54133 CAY54132 CAY54131 CAH69198 CAH69196 CAH04985 CAH69197 |
4565 |
| Zea mays | Zea mays | NP_001147136 ACN30979 ACN30979 ACN31691 |
4577 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.